PIAS4 Antibody / PIASg | R32550

PIAS4 Antibody / PIASg | R32550 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Human, Mouse, Rat

Application: WB

Buffer: Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Limitation: This PIAS4 antibody is available for research use only.

Purity: Antigen affinity

Description: Protein inhibitor of activated STAT protein 4 or protein inhibitor of activated STAT protein gamma (PIASg or PIASy), is an enzyme that in humans is encoded by the PIAS4 gene. This gene is mapped to 19p13.3. This gene plays a crucial role as a transcriptional coregulation in various cellular pathways, including the STAT pathway, the p53/TP53 pathway, the Wnt pathway and the steroid hormone signaling pathway. It also functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, stabilizing the interaction between UBE2I and the substrate, and as a SUMO-tethering factor. This gene involved in gene silencing.

Immunogen: Amino acids 130-174 (EVRLVKLPFFNMLDELLKPTELVPQNNEKLQESPCIFALTPRQVE) from the human protein were used as the immunogen for the PIAS4 antibody.

Storage: After reconstitution, the PIAS4 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.