Superoxide Dismutase 2 Antibody / SOD2 | RQ7037

Superoxide Dismutase 2 Antibody / SOD2 | RQ7037 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: 2B12B1

Host Animal: Mouse

Clonality: Monoclonal (mouse origin)

Species Reactivity: Human, Mouse

Application: WB, IHC-P

Buffer: Lyophilized from 1X PBS with 2% Trehalose

Limitation: This Superoxide Dismutase 2 antibody is available for research use only.

Purity: Antigen affinity purified

Description: SOD2 (Superoxide Dismutase 2), also called IPO-B or MNSOD, is a mitochondrial matrix enzyme that scavenges oxygen radicals produced by the extensive oxidation-reduction and electron transport reactions occurring in mitochondria. This gene is a member of the iron/manganese superoxide dismutase family. Using a somatic cell hybrid panel containing different segments of chromosome 6, they demonstrated that SOD2 is located in the region 6q25.3-qter which, together with the FISH analysis, indicated that SOD2 is in the distal portion of 6q25. The SOD2 gene encodes an intramitochondrial free radical scavenging enzyme that is the first line of defense against superoxide produced as a byproduct of oxidative phosphorylation. Adeno-associated viral delivery of the human SOD2 gene resulted in suppression of optic nerve degeneration and rescue of retinal ganglion cells. The findings suggested that reactive oxygen species contributed to retinal cell death and optic nerve damage in mice with complex I deficiency, and that expression of SOD2 attenuated the disease process.

Immunogen: C-terminal amino acids QYKNVRPDYLKAIWNVINWENVTERYMACKK were used as the immunogen for the Superoxide Dismutase 2 antibody.

Storage: After reconstitution, the Superoxide Dismutase 2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.