MRP1 Antibody / ABCC1 | R32709

MRP1 Antibody / ABCC1 | R32709 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Human

Application: WB

Buffer: Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide

Limitation: This ABCC1 antibody is available for research use only.

Purity: Antigen affinity

Description: Multidrug resistance-associated protein 1 (MRP1) is a protein that in humans is encoded by the ABCC1 gene. The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra-and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This full transporter is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a multispecific organic anion transporter, with oxidized glutatione, cysteinyl leukotrienes, and activated aflatoxin B1 as substrates. This protein also transports glucuronides and sulfate conjugates of steroid hormones and bile salts. Alternatively spliced variants of this gene have been described but their full-length nature is unknown.

Immunogen: Amino acids 1493-1528 (DYTRVIVLDKGEIQEYGAPSDLLQQRGLFYSMAKDA) from the human protein were used as the immunogen for the ABCC1 antibody.

Storage: After reconstitution, the ABCC1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.