ZP2 Antibody | R32192

ZP2 Antibody | R32192 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Human

Application: WB, IHC-P, IHC-F

Buffer: N/A

Limitation: This ZP2 antibody is available for research use only.

Purity: Antigen affinity

Description: Zona pellucida sperm-binding protein 2 is a protein that in humans is encoded by the ZP2 gene. The sperm-binding domain on the ZP2 protein is necessary in both humans and mice for oocyte-sperm recognition and penetration of the zona pellucida. It is also responsible for the primary block to polyspermy in mammals. The oocyte has cortical granules peripherally located under the cortex that contain a proteolytic protein called ovastacin. After the sperm binds to ZP2, the cortical granules are exocytosed releasing ovastacin into the perivitelline space. Ovastacin cleaves ZP2 at the N terminus, preventing more sperm from binding and penetrating the oocyte, thus hardening the zona pellucida. Ovastacin is only found in oocytes, and is part of the astacin family of metalloendoproteases. Female mice engineered without ovastacin showed that ZP2 was not cleaved after fertilization.

Immunogen: Amino acids ENEYPLVRFLRQPIYMEVRVLNRDDPNIKLVLDD of human ZP2 were used as the immunogen for the ZP2 antibody.

Storage: After reconstitution, the ZP2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.