ZEB1 Antibody | RQ5497

ZEB1 Antibody | RQ5497 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Human

Application: WB, IHC-P, IF, FACS

Buffer: Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

Limitation: This ZEB1 antibody is available for research use only.

Purity: Affinity purified

Description: Zinc finger E-box-binding homeobox 1 is a protein that in humans is encoded by the ZEB1 gene. It is mapped to 10p11.22. This gene encodes a zinc finger transcription factor. The encoded protein likely plays a role in transcriptional repression of interleukin 2. Mutations in this gene have been associated with posterior polymorphous corneal dystrophy-3 and late-onset Fuchs endothelial corneal dystrophy. Alternatively spliced transcript variants encoding different isoforms have been described.

Immunogen: Amino acids LLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQ were used as the immunogen for the ZEB1 antibody.

Storage: After reconstitution, the ZEB1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.