Description
YAP1 Antibody | R32393 | Gentaur US, UK & Europe Disrtribition
Family: Primary antibody
Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format: Antigen affinity purified
Clone: N/A
Host Animal: Rabbit
Clonality: Polyclonal (rabbit origin)
Species Reactivity: Human, Mouse, Rat
Application: WB, IF, FACS
Buffer: N/A
Limitation: This YAP1 antibody is available for research use only.
Purity: Antigen affinity
Description: Yes-associated protein 1, also known as YAP or YAP65, is a potent oncogene, which is amplified in various human cancers. This gene encodes a downstream nuclear effector of the Hippo signaling pathway which is involved in development, growth, repair, and homeostasis. It is known to play a role in the development and progression of multiple cancers as a transcriptional regulator of this signaling pathway and may function as a potential target for cancer treatment. Alternative splicing results in multiple transcript variants encoding different isoforms.
Immunogen: Amino acids ETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFK from the human protein were used as the immunogen for the YAP1 antibody.
Storage: After reconstitution, the YAP1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.
