VRK1 Antibody | R32317

(No reviews yet) Write a Review
SKU:
800-R32317
Weight:
1.20 KGS
€986.00
Frequently bought together:

Description

VRK1 Antibody | R32317 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Human, Rat

Application: WB

Buffer: N/A

Limitation: This VRK1 antibody is available for research use only.

Purity: Antigen affinity

Description: Serine/threonine-protein kinase VRK1 is an enzyme that in humans is encoded by the VRK1 gene. This gene encodes a member of the vaccinia-related kinase (VRK) family of serine/threonine protein kinases. It is widely expressed in human tissues and has increased expression in actively dividing cells, such as those in testis, thymus, fetal liver, and carcinomas. Its protein localizes to the nucleus and has been shown to promote the stability and nuclear accumulation of a transcriptionally active p53 molecule and, in vitro, to phosphorylate Thr18 of p53 and reduce p53 ubiquitination. This gene, therefore, may regulate cell proliferation. This protein also phosphorylates histone, casein, and the transcription factors ATF2 (activating transcription factor 2) and c-JUN.

Immunogen: Amino acids EKNKPGEIAKYMETVKLLDYTEKPLYENLRDILLQGLK of human VRK1 were used as the immunogen for the VRK1 antibody.

Storage: After reconstitution, the VRK1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

View AllClose

Additional Information

Size:
100 ug
View AllClose