Description
ULK1 Antibody | RQ6015 | Gentaur US, UK & Europe Disrtribition
Family: Primary antibody
Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format: Antigen affinity purified
Clone: N/A
Host Animal: Rabbit
Clonality: Polyclonal (rabbit origin)
Species Reactivity: Human, Mouse, Rat
Application: WB, IHC-P, FACS
Buffer: Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Limitation: This ULK1 antibody is available for research use only.
Purity: Affinity purified
Description: ULK1 is an enzyme that in humans is encoded by the ULK1 gene. It is mapped to 12q24.33. Unc-51 like autophagy activating kinase (ULK1/2) are two similar isoforms of an enzyme that in humans are encoded by the ULK1/2 genes. It is specifically a kinase that is involved with autophagy, particularly in response to amino acid withdrawal. Not many studies have been done comparing the two isoforms, but some differences have been recorded.
Immunogen: Amino acids EETLMEQEHTEILRGLRFTLLFVQHVLEIAALK from the human protein were used as the immunogen for the ULK1 antibody.
Storage: After reconstitution, the ULK1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.
