UHRF2 Antibody / NIRF | RQ6582

(No reviews yet) Write a Review
SKU:
800-RQ6582
Weight:
1.20 KGS
€986.00
Frequently bought together:

Description

UHRF2 Antibody / NIRF | RQ6582 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Human, Rat

Application: WB, IF, FACS

Buffer: Lyophilized from 1X PBS with 2% Trehalose

Limitation: This NIRF antibody is available for research use only.

Purity: Antigen affinity purified

Description: E3 ubiquitin-protein ligase UHRF2 is an enzyme that in humans is encoded by the UHRF2 gene. This gene encodes a nuclear protein which is involved in cell-cycle regulation. The encoded protein is a ubiquitin-ligase capable of ubiquinating PCNP (PEST-containing nuclear protein), and together they may play a role in tumorigenesis. The encoded protein contains an NIRF_N domain, a PHD finger, a set- and ring-associated (SRA) domain, and a RING finger domain and several of these domains have been shown to be essential for the regulation of cell proliferation. This protein may also have a role in intranuclear degradation of polyglutamine aggregates. Alternative splicing results in multiple transcript variants some of which are non-protein coding.

Immunogen: N-terminal region amino acids TIEDVSRKATIEELRERVWALFDVRPECQRLFYRGKQLEN from the human protein were used as the immunogen for the NIRF antibody.

Storage: After reconstitution, the NIRF antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

View AllClose

Additional Information

Size:
100 ug
View AllClose