Description
TSG101 Antibody | R32315 | Gentaur US, UK & Europe Disrtribition
Family: Primary antibody
Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format: Antigen affinity purified
Clone: N/A
Host Animal: Rabbit
Clonality: Polyclonal (rabbit origin)
Species Reactivity: Human, Rat
Application: WB
Buffer: N/A
Limitation: This TSG101 antibody is available for research use only.
Purity: Antigen affinity
Description: TSG101, known as Tumor susceptibility gene 101, is mapped to 11p15. The protein encoded by this gene belongs to a group of apparently inactive homologs of ubiquitin-conjugating enzymes. The gene product contains a coiled-coil domain that interacts with stathmin, a cytosolic phosphoprotein implicated in tumorigenesis. And the protein may play a role in cell growth and differentiation and act as a negative growth regulator. In vitro steady-state expression of this tumor susceptibility gene appears to be important for maintenance of genomic stability and cell cycle regulation. Mutations and alternative splicing in this gene occur in high frequency in breast cancer and suggest that defects occur during breast cancer tumorigenesis and/or progression.
Immunogen: Amino acids KHVRLLSRKQFQLRALMQKARKTAGLSDLY of human TSG101 were used as the immunogen for the TSG101 antibody.
Storage: After reconstitution, the TSG101 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.
