Description
TREX1 Antibody | R32336 | Gentaur US, UK & Europe Disrtribition
Family: Primary antibody
Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format: Antigen affinity purified
Clone: N/A
Host Animal: Rabbit
Clonality: Polyclonal (rabbit origin)
Species Reactivity: Human
Application: WB
Buffer: N/A
Limitation: This TREX1 antibody is available for research use only.
Purity: Antigen affinity
Description: Three prime repair exonuclease 1 is an enzyme that in humans is encoded by the TREX1 gene. This gene encodes a nuclear protein with 3' exonuclease activity. The encoded protein may play a role in DNA repair and serve as a proofreading function for DNA polymerase. It is also a component of the SET complex, and acts to rapidly degrade 3' ends of nicked DNA during granzyme A-mediated cell death. Mutations in this gene result in Aicardi-Goutieres syndrome, chilblain lupus, Cree encephalitis, and other diseases of the immune system. Alternative splicing results in multiple transcript variants.
Immunogen: Amino acids DDNLANLLLAFLRRQPQPWCLVAHNGDRYD of human TREX1 were used as the immunogen for the TREX1 antibody.
Storage: After reconstitution, the TREX1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.