Description
TPR Antibody / Translocated promoter region protein | RQ7045 | Gentaur US, UK & Europe Disrtribition
Family: Primary antibody
Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format: Antigen affinity purified
Clone: N/A
Host Animal: Rabbit
Clonality: Polyclonal (rabbit origin)
Species Reactivity: Human, Mouse, Rat
Application: WB, IHC-P, IF, FACS
Buffer: Lyophilized from 1X PBS with 2% Trehalose
Limitation: This TPR antibody is available for research use only.
Purity: Antigen affinity purified
Description: The tetratricopeptide repeat (TPR) is a structural motif. This gene encodes a large coiled-coil protein that forms intranuclear filaments attached to the inner surface of nuclear pore complexes (NPCs). The protein directly interacts with several components of the NPC. It is required for the nuclear export of mRNAs and some proteins. Oncogenic fusions of the 5' end of this gene with several different kinase genes occur in some neoplasias.
Immunogen: Amino acids AAVLQQVLERTELNKLPKSVQNKLEKFLADQQ were used as the immunogen for the TPR antibody.
Storage: After reconstitution, the TPR antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.
