Description
TMEM166 Antibody / EVA1A | RQ4951 | Gentaur US, UK & Europe Disrtribition
Family: Primary antibody
Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format: Antigen affinity purified
Clone: N/A
Host Animal: Rabbit
Clonality: Polyclonal (rabbit origin)
Species Reactivity: Human
Application: WB, IHC-P, FACS
Buffer: Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Limitation: This TMEM166 antibody is available for research use only.
Purity: Antigen affinity purified
Description: Eva-1 homolog A (C. elegans) is a protein that in humans is encoded by the EVA1A gene. It belongs to the FAM176 family. This gene is mapped to 2p12. EVA1A, also called TMEM166, acts as a regulator of programmed cell death, mediating both autophagy and apoptosis.
Immunogen: Amino acids MRLPLSHSPEHVEMALLSNILAAYSFVSENPERA from the human protein were used as the immunogen for the TMEM166 antibody.
Storage: After reconstitution, the TMEM166 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.
