TMEM166 Antibody / EVA1A | RQ4951

(No reviews yet) Write a Review
SKU:
800-RQ4951
Weight:
1.20 KGS
€986.00
Frequently bought together:

Description

TMEM166 Antibody / EVA1A | RQ4951 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Human

Application: WB, IHC-P, FACS

Buffer: Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

Limitation: This TMEM166 antibody is available for research use only.

Purity: Antigen affinity purified

Description: Eva-1 homolog A (C. elegans) is a protein that in humans is encoded by the EVA1A gene. It belongs to the FAM176 family. This gene is mapped to 2p12. EVA1A, also called TMEM166, acts as a regulator of programmed cell death, mediating both autophagy and apoptosis.

Immunogen: Amino acids MRLPLSHSPEHVEMALLSNILAAYSFVSENPERA from the human protein were used as the immunogen for the TMEM166 antibody.

Storage: After reconstitution, the TMEM166 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

View AllClose

Additional Information

Size:
100 ug
View AllClose