Description
TMEM107 Antibody | R32772 | Gentaur US, UK & Europe Disrtribition
Family: Primary antibody
Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format: Antigen affinity purified
Clone: N/A
Host Animal: Rabbit
Clonality: Polyclonal (rabbit origin)
Species Reactivity: Human
Application: WB, IHC-P, FACS
Buffer: Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
Limitation: This TMEM107 antibody is available for research use only.
Purity: Antigen affinity
Description: Cilia are dynamic signaling organelles essential for developmental patterning, including left-right specification, skeletal formation, neural development, and organogenesis. TMEM107 is predicted to be critical for cilia formation and signaling in a subset of embryonic tissues. Based on an alignment of the TMEM107 sequence with the genomic sequence (GRCh38), the gene was mapped to chromosome 17p13.1.
Immunogen: Amino acids 22-57 (VITLFWSRDSNIQACLPLTFTPEEYDKQDIQLVAAL) from the human protein were used as the immunogen for the TMEM107 antibody.
Storage: After reconstitution, the TMEM107 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.
