TIMP3 Antibody | R32715

TIMP3 Antibody | R32715 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Human, Mouse, Rat

Application: WB, ELISA

Buffer: Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide

Limitation: This TIMP3 antibody is available for research use only.

Purity: Antigen affinity

Description: Metalloproteinase inhibitor 3 is a protein that in humans is encoded by the TIMP3 gene. It is mapped to 22q12.1-q13.2. This gene belongs to the tissue inhibitor of metalloproteinases gene family. The proteins encoded by this gene family are inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of theextracellular matrix (ECM). Expression of this gene is induced in response to mitogenic stimulation and this netrin domain-containing protein is localized to the ECM. Mutations in this gene have been associated with the autosomal dominant disorder Sorsby's fundus dystrophy.

Immunogen: Amino acids 107-141 (RVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHL) from the human protein were used as the immunogen for the TIMP3 antibody.

Storage: After reconstitution, the TIMP3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.