Thrombospondin 2 Antibody / THBS2 | RQ4469

Thrombospondin 2 Antibody / THBS2 | RQ4469 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Mouse, Rat

Application: WB

Buffer: Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

Limitation: This THBS2 antibody is available for research use only.

Purity: Antigen affinity

Description: Thrombospondin-2 (THBS2) is a protein that in humans is encoded by the THBS2 gene. The protein encoded by this gene belongs to the thrombospondin family. The THBS2 is mapped to 6q27 and it is located on chromosome 17. The gene was transcribed in fibroblasts, smooth muscle cells, and an osteosarcoma cell line. It functions as a protein inhibitor of tumor growth and angiogenesis and modulates the cell surface properties of mesenchymal cells and be involved in cell adhesion and migration.

Immunogen: Amino acids DHVKDTSFDLFSISNINRKTIGAKQFRGPD were used as the immunogen for the THBS2 antibody.

Storage: After reconstitution, the THBS2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.