Description
TGFBR2 Antibody / TGF beta Receptor II | R32086 | Gentaur US, UK & Europe Disrtribition
Family: Primary antibody
Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format: Antigen affinity purified
Clone: N/A
Host Animal: Rabbit
Clonality: Polyclonal (rabbit origin)
Species Reactivity: Human
Application: WB
Buffer: N/A
Limitation: This TGF beta Receptor II antibody is available for research use only.
Purity: Antigen affinity
Description: TGFBR2 (Transforming growth factor, beta receptor II) is a member of the Ser/Thr protein kinase family and the TGFB receptor subfamily. It is a transmembrane protein that has a protein kinase domain, forms a heterodimeric complex with another receptor protein, and binds TGF-beta. This receptor/ligand complex phosphorylates proteins, which then enter the nucleus and regulate the transcription of a subset of genes related to cell proliferation. Mutations in this gene have been associated with Marfan syndrome, Loeys-Deitz aortic aneurysm syndrome, Osler-Weber-Rendu syndrome, and the development of various types of tumors. Alternatively spliced transcript variants encoding different informs have been characterized.
Immunogen: Amino acids TLETVCHDPKLPYHDFILEDAASPKCIMKEKKK of human TGFBR2 were used as the immunogen for the TGF beta Receptor II antibody.
Storage: After reconstitution, the TGF beta Receptor II antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.
