Description
TCP1 gamma Antibody / CCT3 | R32392 | Gentaur US, UK & Europe Disrtribition
Family: Primary antibody
Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format: Antigen affinity purified
Clone: N/A
Host Animal: Rabbit
Clonality: Polyclonal (rabbit origin)
Species Reactivity: Human, Rat
Application: WB, FACS, IHC-P, IF/ICC
Buffer: N/A
Limitation: This CCT3 antibody is available for research use only.
Purity: Antigen affinity
Description: T-complex protein 1 subunit gamma is a protein that in humans is encoded by the CCT3 gene. The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants have been characterized for this gene. In addition, a pseudogene of this gene has been found on chromosome 8.
Immunogen: Amino acids EPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKGDDQSRQ were used as the immunogen for the CCT3 antibody.
Storage: After reconstitution, the CCT3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.
