SUMO1 Antibody | RQ6212

(No reviews yet) Write a Review
SKU:
800-RQ6212
Weight:
1.20 KGS
€986.00
Frequently bought together:

Description

SUMO1 Antibody | RQ6212 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Human, Mouse, Rat

Application: IHC-P, IF, FACS

Buffer: N/A

Limitation: This SUMO1 antibody is available for research use only.

Purity: Affinity purified

Description: Small ubiquitin-related modifier 1(SUMO1), also called SMT3C or PIC1 is a protein that in humans is encoded by the SUMO1 gene. This gene is mapped to 2q33.1. This gene encodes a protein that is a member of the SUMO(small ubiquitin-like modifier) protein family. It functions in a manner similar to ubiquitin in that it is bound to target proteins as part of a post-translational modification system. However, unlike ubiquitin which targets proteins for degradation, this protein is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. It is not active until the last four amino acids of the carboxy-terminus have been cleaved off. Several pseudogenes have been reported for this gene.

Immunogen: Amino acids HLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKEL from the human protein were used as the immunogen for the SUMO1 antibody.

Storage: After reconstitution, the SUMO1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

View AllClose

Additional Information

Size:
100 ug
View AllClose