Description
SUMO1 Antibody | RQ6212 | Gentaur US, UK & Europe Disrtribition
Family: Primary antibody
Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format: Antigen affinity purified
Clone: N/A
Host Animal: Rabbit
Clonality: Polyclonal (rabbit origin)
Species Reactivity: Human, Mouse, Rat
Application: IHC-P, IF, FACS
Buffer: N/A
Limitation: This SUMO1 antibody is available for research use only.
Purity: Affinity purified
Description: Small ubiquitin-related modifier 1(SUMO1), also called SMT3C or PIC1 is a protein that in humans is encoded by the SUMO1 gene. This gene is mapped to 2q33.1. This gene encodes a protein that is a member of the SUMO(small ubiquitin-like modifier) protein family. It functions in a manner similar to ubiquitin in that it is bound to target proteins as part of a post-translational modification system. However, unlike ubiquitin which targets proteins for degradation, this protein is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. It is not active until the last four amino acids of the carboxy-terminus have been cleaved off. Several pseudogenes have been reported for this gene.
Immunogen: Amino acids HLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKEL from the human protein were used as the immunogen for the SUMO1 antibody.
Storage: After reconstitution, the SUMO1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.
