Description
STXBP2 Antibody / UNC18-2 | R32239 | Gentaur US, UK & Europe Disrtribition
Family: Primary antibody
Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format: Antigen affinity purified
Clone: N/A
Host Animal: Rabbit
Clonality: Polyclonal (rabbit origin)
Species Reactivity: Human, Mouse, Rat
Application: WB, IF, FACS
Buffer: N/A
Limitation: This STXBP2 antibody is available for research use only.
Purity: Antigen affinity
Description: Syntaxin-binding protein 2, also known as UNC18B and UNC18-2, is a protein that in humans is encoded by the STXBP2 gene. The STXBP2 gene is mapped to human chromosome 19p13.3-p13.2 and to the proximal arm of mouse chromosome 8. And this gene encodes a member of the STXBP/unc-18/SEC1 family. The encoded protein is involved in intracellular trafficking, control of SNARE (soluble NSF attachment protein receptor) complex assembly, and the release of cytotoxic granules by natural killer cells. Additionally, UNC18B is expressed predominantly as a 2.4-kb message in placenta, lung, liver, kidney, and pancreas, as well as in peripheral blood lymphocytes. Mutations in this gene are associated with familial hemophagocytic lymphohistiocytosis. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.
Immunogen: Amino acids QEYPAIRYRKGPEDTAQLAHAVLAKLNAFKAD of human STXBP2 were used as the immunogen for the STXBP2 antibody.
Storage: After reconstitution, the STXBP2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.
