STAT2 Antibody | RQ4293

STAT2 Antibody | RQ4293 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Mouse, Rat

Application: WB

Buffer: Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

Limitation: This STAT2 antibody is available for research use only.

Purity: Antigen affinity purified

Description: Signal transducer and activator of transcription 2 is a protein that in humans is encoded by the STAT2 gene. The protein encoded by this gene is a member of the STAT protein family. The International Radiation Hybrid Mapping Consortium mapped the STAT2 gene to chromosome 12. STAT2 is a transcription factor critical to the signal transduction pathway of type I interferons. ISGF3 (STAT2) assembly involves p48 functioning as an adaptor protein to recruit Stat1 and Stat2 to an IFN-alpha-stimulated response element, Stat2 contributes a potent transactivation domain but is unable to directly contact DNA, while Stat1 stabilizes the heteromeric complex by contacting DNA directly.

Immunogen: Amino acids FQDQLHQLYSHSLLPVDIRQYLAVWIEDQNWQEA were used as the immunogen for the STAT2 antibody.

Storage: After reconstitution, the STAT2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.