StAR Antibody / Steroidogenic acute regulatory protein | RQ4391

StAR Antibody / Steroidogenic acute regulatory protein | RQ4391 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Mouse, Rat

Application: WB

Buffer: Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

Limitation: This StAR antibody is available for research use only.

Purity: Antigen affinity purified

Description: The steroidogenic acute regulatory protein, commonly referred to as StAR (STARD1), is a transport protein. This protein plays a key role in the acute regulation of steroid hormone synthesis by enhancing the conversion of cholesterol into pregnenolone. It permits the cleavage of cholesterol into pregnenolone by mediating the transport of cholesterol from the outer mitochondrial membrane to the inner mitochondrial membrane. Mutations in this gene are a cause of congenital lipoid adrenal hyperplasia (CLAH), also called lipoid CAH. A pseudogene of this gene is located on chromosome 13.

Immunogen: Amino acids EETLYSDQELAYLQQGEEAMQKALGILSNQEGWKKESQQD from the human protein were used as the immunogen for the StAR antibody.

Storage: After reconstitution, the StAR antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.