Description
SRY Antibody / Sex-Determining Region Y (Middle Region) | R32850 | Gentaur US, UK & Europe Disrtribition
Family: Primary antibody
Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format: Antigen affinity purified
Clone: N/A
Host Animal: Rabbit
Clonality: Polyclonal (rabbit origin)
Species Reactivity: Human
Application: WB
Buffer: Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
Limitation: This SRY antibody is available for research use only.
Purity: Antigen affinity
Description: This intronless gene encodes a transcription factor that is a member of the high mobility group (HMG)-box family of DNA-binding proteins. This protein is the testis-determining factor (TDF) or Sex-determining region Y (SRY), which initiates male sex determination. Mutations in this gene give rise to XY females with gonadal dysgenesis (Swyer syndrome); translocation of part of the Y chromosome containing this gene to the X chromosome causes XX male syndrome.
Immunogen: Amino acids 90-130 (ISKQLGYQWKMLTEAEKWPFFQEAQKLQAMHREKYPNYKYR) were used as the immunogen for the SRY antibody.
Storage: After reconstitution, the SRY antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.
