Sp5 Antibody | R32265

Sp5 Antibody | R32265 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Human

Application: WB, IHC-P

Buffer: N/A

Limitation: This Sp5 antibody is available for research use only.

Purity: Antigen affinity

Description: Sp5 is mapped to 2q31.1. It is a member of the Sp family of zinc finger transcription factors. Like other family members, the Sp5 protein contains a Cys2His2 zinc finger DNA binding domain at the C-terminus. Elevated expression of Sp5 has been noted in several human tumors including hepatocellular carcinoma, gastric cancer and colon cancer.

Immunogen: Amino acids DFAQYQSQIAALLQTKAPLAATARRCRRCR of human Sp5 were used as the immunogen for the Sp5 antibody.

Storage: After reconstitution, the Sp5 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.