Sorcin Antibody / SRI | RQ4661

(No reviews yet) Write a Review
SKU:
800-RQ4661
Weight:
1.20 KGS
€986.00
Frequently bought together:

Description

Sorcin Antibody / SRI | RQ4661 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Human, Mouse, Rat

Application: WB, IHC-P

Buffer: N/A

Limitation: This SRI antibody is available for research use only.

Purity: Antigen affinity purified

Description: Sorcinis aproteinthat in humans is encoded by theSRIgene. It is mapped to 7q21.1. This gene encodes a calcium-binding protein with multiple E-F hand domains that relocates from the cytoplasm to the sarcoplasmic reticulum in response to elevated calcium levels. In addition to regulating intracellular calcium homeostasis it also modulates excitation-contraction coupling in the heart. Alternative splicing results in multiple transcript variants encoding distinct proteins. Multiple pseudogenes exist for this gene.

Immunogen: Amino acids TVDPQELQKALTTMGFRLSPQAVNSIAKRY were used as the immunogen for the SRI antibody.

Storage: After reconstitution, the SRI antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

View AllClose

Additional Information

Size:
100 ug
View AllClose