SMYD3 Antibody | R32321

(No reviews yet) Write a Review
SKU:
800-R32321
Weight:
1.20 KGS
€986.00
Frequently bought together:

Description

SMYD3 Antibody | R32321 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Human

Application: WB, IHC-P

Buffer: N/A

Limitation: This SMYD3 antibody is available for research use only.

Purity: Antigen affinity

Description: SET and MYND domain-containing protein 3 is a protein that in humans is encoded by the SMYD3 gene. The International Radiation Hybrid Mapping Consortium mapped the SMYD3 gene to chromosome 1. This gene encodes a histone methyltransferase which functions in RNA polymerase II complexes by an interaction with a specific RNA helicase. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen: Amino acids QAMKNLRLAFDIMRVTHGREHSLIEDLILLLEECDANIRAS of human SMYD3 were used as the immunogen for the SMYD3 antibody.

Storage: After reconstitution, the SMYD3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

View AllClose

Additional Information

Size:
100 ug
View AllClose