SLC7A3 Antibody (N-Terminal) | R32985

SLC7A3 Antibody (N-Terminal) | R32985 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Human

Application: WB

Buffer: Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide

Limitation: This SLC7A3 antibody is available for research use only.

Purity: Antigen affinity

Description: Cationic amino acid transporter 3 is a protein that in humans is encoded by the SLC7A3 gene. This gene encodes a member of the solute carrier family 7. The encoded protein is a sodium-independent cationic amino acid transporter. Alternate splicing results in multiple transcripts that encoded the same protein. The International Radiation Hybrid Mapping Consortium mapped the SLC7A3 gene to the X chromosome.

Immunogen: Amino acids 1-30 (MPWQAFRRFGQKLVRRRTLESGMAETRLAR) were used as the immunogen for the SLC7A3 antibody.

Storage: After reconstitution, the SLC7A3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.