Description
SLC34A2 Antibody | RQ4878 | Gentaur US, UK & Europe Disrtribition
Family: Primary antibody
Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format: Antigen affinity purified
Clone: N/A
Host Animal: Rabbit
Clonality: Polyclonal (rabbit origin)
Species Reactivity: Human, Mouse, Rat
Application: WB, IHC-P, IF, FACS
Buffer: Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Limitation: This SLC34A2 antibody is available for research use only.
Purity: Antigen affinity purified
Description: Sodium-dependent phosphate transport protein 2B (NaPi2b) is a protein that in humans is encoded by the SLC34A2 gene. The protein encoded by this gene is a pH-sensitive sodium-dependent phosphate transporter. Phosphate uptake is increased at lower pH. Defects in this gene are a cause of pulmonary alveolar microlithiasis. Three transcript variants encoding two different isoforms have been found for this gene.
Immunogen: Amino acids QNWTMKNVTYKENIAKCQHIFVNFHLPDLA from the human protein were used as the immunogen for the SLC34A2 antibody.
Storage: After reconstitution, the SLC34A2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.
