SLC34A2 Antibody | RQ4878

(No reviews yet) Write a Review
SKU:
800-RQ4878
Weight:
1.20 KGS
€986.00
Frequently bought together:

Description

SLC34A2 Antibody | RQ4878 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Human, Mouse, Rat

Application: WB, IHC-P, IF, FACS

Buffer: Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

Limitation: This SLC34A2 antibody is available for research use only.

Purity: Antigen affinity purified

Description: Sodium-dependent phosphate transport protein 2B (NaPi2b) is a protein that in humans is encoded by the SLC34A2 gene. The protein encoded by this gene is a pH-sensitive sodium-dependent phosphate transporter. Phosphate uptake is increased at lower pH. Defects in this gene are a cause of pulmonary alveolar microlithiasis. Three transcript variants encoding two different isoforms have been found for this gene.

Immunogen: Amino acids QNWTMKNVTYKENIAKCQHIFVNFHLPDLA from the human protein were used as the immunogen for the SLC34A2 antibody.

Storage: After reconstitution, the SLC34A2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

View AllClose

Additional Information

Size:
100 ug
View AllClose