SCN4B Antibody | RQ4934

(No reviews yet) Write a Review
SKU:
800-RQ4934
Weight:
1.20 KGS
€986.00
Frequently bought together:

Description

SCN4B Antibody | RQ4934 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Human, Mouse, Rat

Application: WB, IHC-P, FACS

Buffer: Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

Limitation: This SCN4B antibody is available for research use only.

Purity: Antigen affinity purified

Description: Sodium channel beta-subunit 4, also known as SCN4B or Na?4, is a protein that in humans is encoded by the SCN4B gene. The protein encoded by this gene is one of several sodium channel beta subunits. These subunits interact with voltage-gated alpha subunits to change sodium channel kinetics. The encoded transmembrane protein forms interchain disulfide bonds with SCN2A. Defects in this gene are a cause of long QT syndrome type 10 (LQT10). Three protein-coding and one non-coding transcript variant have been found for this gene.

Immunogen: Amino acids LRDLEFSDTGKYTCHVKNPKENNLQHHATIFLQ from the human protein were used as the immunogen for the SCN4B antibody.

Storage: After reconstitution, the SCN4B antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

View AllClose

Additional Information

Size:
100 ug
View AllClose