RXFP2 Antibody / Relaxin Receptor 2 | RQ4608

(No reviews yet) Write a Review
SKU:
800-RQ4608
Weight:
1.20 KGS
€986.00
Frequently bought together:

Description

RXFP2 Antibody / Relaxin Receptor 2 | RQ4608 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Human

Application: WB, FACS

Buffer: N/A

Limitation: This RXFP2 antibody is available for research use only.

Purity: Antigen affinity purified

Description: Relaxin/insulin-like family peptide receptor 2, also known as RXFP2, is a human G-protein coupled receptor. It is mapped to 13q13.1. This gene encodes a member of the GPCR (G protein-coupled, 7-transmembrane receptor) family. Mutations in this gene are associated with cryptorchidism. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Immunogen: Amino acids MIVFLVFKHLFSLRLITMFFLLHFIVLINVKDFALTQ were used as the immunogen for the RXFP2 antibody.

Storage: After reconstitution, the RXFP2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

View AllClose

Additional Information

Size:
100 ug
View AllClose