Description
RUNX2 Antibody | R31577 | Gentaur US, UK & Europe Disrtribition
Family: Primary antibody
Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format: Antigen affinity purified
Clone: N/A
Host Animal: Rabbit
Clonality: Polyclonal (rabbit origin)
Species Reactivity: Human
Application: WB
Buffer: N/A
Limitation: This RUNX2 antibody is available for research use only.
Purity: Antigen affinity
Description: Core binding factor A1 (CBFA1/RUNX2) is a runt-like transcription factor essential for osteoblast differentiation. This protein is a member of the RUNX family of transcription factors and has a Runt DNA-binding domain. It is essential for osteoblastic differentiation and skeletal morphogenesis and acts as a scaffold for nucleic acids and regulatory factors involved in skeletal gene expression. RUNX2 plays a non-redundant role for Cbfa1 in tooth development that may be distinct from that in bone formation. In odontogenesis, RUNX2 is not involved in the early signaling networks regulating tooth initiation and early morphogenesis but regulates key epithelial-mesenchymal interactions that control advancing morphogenesis and histodifferentiation of the epithelial enamel organ.
Immunogen: An amino acid sequence from the middle region of human RUNX2 (DRLSDLGRIPHPSMRVGVPPQNPRPSLNSAPSPFN) was used as the immunogen for this RUNX2 antibody (100% mouse homology).
Storage: After reconstitution, the RUNX2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.
