Description
RUNX1 Antibody | R31576 | Gentaur US, UK & Europe Disrtribition
Family: Primary antibody
Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format: Antigen affinity purified
Clone: N/A
Host Animal: Rabbit
Clonality: Polyclonal (rabbit origin)
Species Reactivity: Human, Mouse, Rat
Application: WB, IHC-P, IHC-F
Buffer: N/A
Limitation: This RUNX1 antibody is available for research use only.
Purity: Antigen affinity
Description: Runt-related transcription factor 1, also known as AML1 or CBFA2, is a protein that in humans is encoded by the RUNX1 gene. It belongs to the Runt-related transcription factor (RUNX) family of genes which are also called Core binding factor alpha (CBFa). RUNX1 is a transcription factor that regulates the differentiation of hematopoietic stem cells into mature blood cells. RUNX proteins form a heterodimeric complex with CBFb which confers increased DNA binding and stability to the complex. Chromosomal translocations involving the gene are associated with several types of leukemia including M2 AML. Mutations are implicated in cases of breast cancer.
Immunogen: An amino acid sequence from the middle region of human RUNX1 (ELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFN) was used as the immunogen for this RUNX1 antibody (100% homologous in human, mouse and rat).
Storage: After reconstitution, the RUNX1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.
