RHOB Antibody | RQ4915

(No reviews yet) Write a Review
SKU:
800-RQ4915
Weight:
1.20 KGS
€986.00
Frequently bought together:

Description

RHOB Antibody | RQ4915 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Human, Mouse, Rat, Monkey

Application: WB, IHC-P, IF

Buffer: Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

Limitation: This RHOB antibody is available for research use only.

Purity: Antigen affinity purified

Description: Ras homolog gene family, member B, also known as RHOB, is a protein which in humans is encoded by the RHOB gene. This gene is mapped to 2p24.1. It is a member of the Rho GTP-binding protein family. And RHOB has been shown to interact with CIT, ARHGEF3, ARHGDIG and RHPN2. RHOB plays a negative role in tumorigenesis as deletion causes tumor formation. Also, it serves as a microtubule-dependent signal that is required for the myosin contractile ring formation during cell cycle cytokinesis.

Immunogen: Amino acids NKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLE from the human protein were used as the immunogen for the RHOB antibody.

Storage: After reconstitution, the RHOB antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

View AllClose

Additional Information

Size:
100 ug
View AllClose