RelB Antibody | R32178

(No reviews yet) Write a Review
SKU:
800-R32178
Weight:
1.20 KGS
€986.00
Frequently bought together:

Description

RelB Antibody | R32178 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Human

Application: WB

Buffer: N/A

Limitation: This Rel-B antibody is available for research use only.

Purity: Antigen affinity

Description: RELB (v-rel reticuloendotheliosis viral oncogene homolog B) is also known as IREL. The International Radiation Hybrid Mapping Consortium assigned the RELB gene to chromosome 19. By RT-PCR and immunocytochemical analyses, Clark et al. (1999) showed that RELB expression correlated with dendritic cell activation. NF-kappa-B-inducing kinase is required for osteoclastogenesis in response to pathologic stimuli. Vaira et al. (2008) found that overexpression of Relb, but not Rela, rescued differentiation of mouse Nik -/- osteoclast precursors, indicating that blockade of the alternative NF-kappa-B pathway, rather than the classical NF-kappa-B pathway, is responsible for the osteoclastogenic defect in the absence of Nik. Using Relb -/- mice, they showed that Relb itself was required for Rankl-induced osteoclastogenesis in vitro and for TNF-induced bone resorption in vivo. Both Relb -/- and Nik -/- mice were resistant to tumor-mediated osteolysis. Vaira et al. (2008) concluded that the alternative NF-kappa-B pathway, via RELB, plays an essential and unique role in RANKL signaling toward osteoclast development.

Immunogen: Amino acids RHSFNNLGIQCVRKKEIEAAIERKIQLGIDPYNA of human RELB were used as the immunogen for the Rel-B antibody.

Storage: After reconstitution, the Rel-B antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

View AllClose

Additional Information

Size:
100 ug
View AllClose