RAB14 Antibody | R32156

RAB14 Antibody | R32156 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Human, Rat

Application: WB

Buffer: N/A

Limitation: This RAB14 antibody is available for research use only.

Purity: Antigen affinity

Description: Ras-related protein Rab-14 is a protein that in humans is encoded by the RAB14 gene. It is mapped to 9q33.2 based on an alignment of the RAB14 sequence with the genomic sequence. RAB14 belongs to the large RAB family of low molecular mass GTPases that are involved in intracellular membrane trafficking. These proteins act as molecular switches that flip between an inactive GDP-bound state and an active GTP-bound state in which they recruit downstream effector proteins onto membranes.

Immunogen: Amino acids NKADLEAQRDVTYEEAKQFAEENGLLFLEA of human RAB14 were used as the immunogen for the RAB14 antibody.

Storage: After reconstitution, the RAB14 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.