RAB11A Antibody | RQ6583

RAB11A Antibody | RQ6583 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Human, Mouse, Rat

Application: WB, IHC-P, IF, FACS

Buffer: Lyophilized from 1X PBS with 2% Trehalose

Limitation: This RAB11A antibody is available for research use only.

Purity: Antigen affinity purified

Description: Ras-related protein Rab-11A is a protein that in humans is encoded by the RAB11A gene. The protein encoded by this gene belongs to the small GTPase superfamily, Rab family which plays essential roles in vesicle and granule targeting. It is mapped to 15q22.31. RAB11A is associated with both constitutive and regulated secretory pathways, and may be involved in protein transport. Additionally, RAB11A can control intracellular trafficking of the innate immune receptor TLR4, and thereby also receptor signaling. It has been shown to interact with RAB11FIP2, RAB11FIP4, and RAB11FIP1 and so on.

Immunogen: C-terminal region amino acids EIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQ from the human protein were used as the immunogen for the RAB11A antibody.

Storage: After reconstitution, the RAB11A antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.