Description
PRDM14 Antibody | RQ6394 | Gentaur US, UK & Europe Disrtribition
Family: Primary antibody
Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format: Purified
Clone: N/A
Host Animal: Rabbit
Clonality: Polyclonal (rabbit origin)
Species Reactivity: Human, Mouse, Rat
Application: WB, IHC-P, IF, FACS
Buffer: Lyophilized from 1X PBS with 2% Trehalose
Limitation: This PRDM14 antibody is available for research use only.
Purity: Antigen affinity purified
Description: This gene encodes a member of the PRDI-BF1 and RIZ homology domain containing (PRDM) family of transcriptional regulators. The encoded protein may possess histone methyltransferase activity and plays a critical role in cell pluripotency by suppressing the expression of differentiation marker genes. Expression of this gene may play a role in breast cancer.
Immunogen: Amino acids QNLAAYYTPFPSYGHYRNSLATVEEDFQPFRQLEA were used as the immunogen for the PRDM14 antibody.
Storage: After reconstitution, the PRDM14 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.
