Description
POR Antibody / CYPOR / Cytochrome P450 Oxidoreductase | RQ6592 | Gentaur US, UK & Europe Disrtribition
Family: Primary antibody
Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format: Antigen affinity purified
Clone: N/A
Host Animal: Rabbit
Clonality: Polyclonal (rabbit origin)
Species Reactivity: Human
Application: WB, IHC-P, FACS
Buffer: Lyophilized from 1X PBS with 2% Trehalose
Limitation: This Cytochrome P450 Reductase antibody is available for research use only.
Purity: Antigen affinity purified
Description: POR is a membrane-bound enzyme required for electron transfer from NADPH to cytochrome P450 in the endoplasmic reticulum of the eukaryotic cell. The gene encodes an endoplasmic reticulum membrane oxidoreductase with an FAD-binding domain and a flavodoxin-like domain. The protein binds two cofactors, FAD and FMN, which allow it to donate electrons directly from NADPH to all microsomal P450 enzymes. Mutations in this gene have been associated with various diseases, including apparent combined P450C17 and P450C21 deficiency, amenorrhea and disordered steroidogenesis, congenital adrenal hyperplasia and Antley-Bixler syndrome.
Immunogen: C-terminal region amino acids RNMARDVQNTFYDIVAELGAMEHAQAVDYIKKLMTK from the human protein were used as the immunogen for the Cytochrome P450 Reductase antibody.
Storage: After reconstitution, the Cytochrome P450 Reductase antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.
