Description
PML Antibody / Promyelocytic leukemia protein | R32553 | Gentaur US, UK & Europe Disrtribition
Family: Primary antibody
Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format: Antigen affinity purified
Clone: N/A
Host Animal: Rabbit
Clonality: Polyclonal (rabbit origin)
Species Reactivity: Mouse
Application: WB, IHC-P
Buffer: Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
Limitation: This PML antibody is available for research use only.
Purity: Antigen affinity
Description: Promyelocytic leukemia protein functions via its association with PML-nuclear bodies (PML-NBs) in a wide range of important cellular processes, including tumor suppression, transcriptional regulation, apoptosis, senescence, DNA damage response, and viral defense mechanisms.
Immunogen: Amino acids 140-177 (LADFWCFECEQLICSKCFEAHQWYLKHEARPLADLRDN) from the mouse protein were used as the immunogen for the PML antibody.
Storage: After reconstitution, the PML antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.
