Description
PMEL17 / Melanoma gp100 Antibody | RQ4546 | Gentaur US, UK & Europe Disrtribition
Family: Primary antibody
Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format: Purified
Clone: N/A
Host Animal: Rabbit
Clonality: Polyclonal (rabbit origin)
Species Reactivity: Mouse, Rat
Application: WB
Buffer: N/A
Limitation: This PMEL17 antibody is available for research use only.
Purity: Antigen affinity purified
Description: This gene is mapped to 12q13.2. It encodes a melanocyte-specific type I transmembrane glycoprotein. The encoded protein is enriched in melanosomes, which are the melanin-producing organelles in melanocytes, and plays an essential role in the structural organization of premelanosomes. This protein is involved in generating internal matrix fibers that define the transition from Stage I to Stage II melanosomes. This protein undergoes a complex pattern of prosttranslational processing and modification that is essential to the proper functioning of the protein. A secreted form of this protein that is released by proteolytic ectodomain shedding may be used as a melanoma-specific serum marker. Alternate splicing results in multiple transcript variants.
Immunogen: Amino acids KVPRNQDWLGVSRQLRTKAWNRQLYPEWTEAQRLD were used as the immunogen for the PMEL17 antibody.
Storage: After reconstitution, the PMEL17 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.
