Description
PIM-1 Antibody | R31728 | Gentaur US, UK & Europe Disrtribition
Family: Primary antibody
Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format: Antigen affinity purified
Clone: N/A
Host Animal: Rabbit
Clonality: Polyclonal (rabbit origin)
Species Reactivity: Human
Application: WB
Buffer: N/A
Limitation: This PIM1 antibody is available for research use only.
Purity: Antigen affinity
Description: Proto-oncogene serine/threonine-protein kinase PIM-1 is an enzyme that in humans is encoded by the PIM1 gene. It is mapped to 6p21.2. Primarily expressed in spleen, thymus, bone marrow, prostate, oral epithelial, hippocampus and fetal liver cells, It has also been found to be highly expressed in cell cultures isolated from human tumors. PIM-1 is mainly involved in cell cycle progression, apoptosis and transcriptional activation, as well as more general signal transduction pathways. It has been found a physiologic role of the PIM-1 oncogene during hematopoietic development and a deregulation of the gene in various leukemias. It also has a role in cardioprotection downstream of AKT activation.
Immunogen: An amino acid sequence from the C-terminus of human PIM1 (EEIQNHPWMQDVLLPQETAEIHLHSLSPGPSK) was used as the immunogen for this PIM-1 antibody.
Storage: After reconstitution, the PIM-1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.
