Description
PI3K p110 Antibody (beta) | R32723 | Gentaur US, UK & Europe Disrtribition
Family: Primary antibody
Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format: Antigen affinity purified
Clone: N/A
Host Animal: Rabbit
Clonality: Polyclonal (rabbit origin)
Species Reactivity: Human, Mouse, Rat
Application: WB, IHC-P
Buffer: Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
Limitation: This PI3K p110 antibody is available for research use only.
Purity: Antigen affinity
Description: Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta isoform is an enzyme that in humans is encoded by the PIK3CB gene. This gene encodes an isoform of the catalytic subunit of phosphoinositide 3-kinase (PI3K). These kinases are important in signaling pathways involving receptors on the outer membrane of eukaryotic cells and are named for their catalytic subunit. The encoded protein is the catalytic subunit for PI3Kbeta (PI3KB). PI3KB has been shown to be part of the activation pathway in neutrophils which have bound immune complexes at sites of injury or infection. Alternative splicing results in multiple transcript variants.
Immunogen: Amino acids 556-598 (DLIWTLRQDCREIFPQSLPKLLLSIKWNKLEDVAQLQALLQIW) from the human protein were used as the immunogen for the PI3K p110 antibody.
Storage: After reconstitution, the PI3K p110 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.
