Description
PGP9.5 / UchL1 Antibody | RQ6534 | Gentaur US, UK & Europe Disrtribition
Family: Primary antibody
Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format: Antigen affinity purified
Clone: 3E4
Host Animal: Mouse
Clonality: Monoclonal (mouse origin)
Species Reactivity: Human, Mouse, Rat
Application: WB, IHC-P, FACS
Buffer: Lyophilized from 1X PBS with 2% Trehalose
Limitation: This PGP9.5 antibody is available for research use only.
Purity: Affinity purified
Description: UCH-L1, also known as PGP9.5, is a member of a gene family whose products hydrolyze small C-terminal adducts of ubiquitin to generate the ubiquitin monomer. Expression of UCH-L1 is highly specific to neurons and to cells of the diffuse neuroendocrine system and their tumors. It is abundantly present in all neurons (accounts for 1-2% of total brain protein), expressed specifically in neurons and testis/ovary. The catalytic triad of UCH-L1 contains a cysteine at position 90, an aspartate at position 176, and a histidine at position 161 that are responsible for its hydrolase activity.
Immunogen: Amino acids 120-153 (ETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCR) were used as the immunogen for the PGP9.5 antibody.
Storage: After reconstitution, the PGP9.5 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.