Description
PDPK1 Antibody / 3-phosphoinositide-dependent protein kinase 1 | R31813 | Gentaur US, UK & Europe Disrtribition
Family: Primary antibody
Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format: Antigen affinity purified
Clone: N/A
Host Animal: Rabbit
Clonality: Polyclonal (rabbit origin)
Species Reactivity: Human, Mouse, Rat
Application: WB, IHC-P, IHC-F
Buffer: N/A
Limitation: This PDPK1 antibody is available for research use only.
Purity: Antigen affinity
Description: 3-phosphoinositide dependent protein kinase-1 is a protein which in humans is encoded by the PDPK1 gene. PDPK1 is a master kinase, which is crucial for the activation of AKT/PKB and many other AGC kinases including PKC, S6K, SGK. An important role for PDPK1 is in the signalling pathways activated by several growth factors and hormones including insulin signaling. Mice lacking PDPK1 die during early embryonic development, indicating that this enzyme is critical for transmitting the growth-promoting signals necessary for normal mammalian development.
Immunogen: Amino acids YLMDPSGNAHKWCRKIQEVWRQRYQSHPDAAVQ of human PDPK1 were used as the immunogen for the PDPK1 antibody.
Storage: After reconstitution, the PDPK1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.
