Description
PDIA3 Antibody / ERp57 | RQ7021 | Gentaur US, UK & Europe Disrtribition
Family: Primary antibody
Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format: Antigen affinity purified
Clone: 7E5.
Host Animal: Mouse
Clonality: Monoclonal (mouse origin)
Species Reactivity: Human
Application: WB, IHC-P, FACS
Buffer: Lyophilized from 1X PBS with 2% Trehalose
Limitation: This ERp57 antibody is available for research use only.
Purity: Antigen affinity purified
Description: PDIA3 (Protein disulfide isomerase family A, member 3), also called GRP58, Erp57 or ER60, is an isomerase enzyme. It is mapped on 15q15.3. PDIA3 is also part of the major histocompatibility complex (MHC) class I peptide-loading complex, which is essential for formation of the final antigen conformation and export from the endoplasmic reticulum to the cell surface. This gene encodes a protein of the endoplasmic reticulum that interacts with lectin chaperones calreticulin and calnexin to modulate folding of newly synthesized glycoproteins. The protein was once thought to be a phospholipase; however, it has been demonstrated that the protein actually has protein disulfide isomerase activity. It is thought that complexes of lectins and this protein mediate protein folding by promoting formation of disulfide bonds in their glycoprotein substrates.
Immunogen: C-terminal amino acids RELSDFISYLQREATNPPVIQEEKPKKKKKAQEDL were used as the immunogen for the ERp57 antibody.
Storage: After reconstitution, the ERp57 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.
