PAR1 Antibody / F2R / Thrombin Receptor | R32032

(No reviews yet) Write a Review
SKU:
800-R32032
Weight:
1.20 KGS
€986.00
Frequently bought together:

Description

PAR1 Antibody / F2R / Thrombin Receptor | R32032 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Human

Application: WB, IHC-P

Buffer: N/A

Limitation: This Thrombin Receptor antibody is available for research use only.

Purity: Antigen affinity

Description: Proteinase-activated receptor 1 (PAR-1), also known as the coagulation factor II (thrombin) receptor, is a protein that in humans is encoded by the F2R gene. By fluorescence in situ hybridization, this gene is mapped to 5q13, confirming its presence as a single locus in the human genome. PAR1 is a G protein-coupled receptor involved in the regulation of thrombotic response. Proteolytic cleavage leads to the activation of the receptor. The expression of PAR1 is both required and sufficient to promote growth and invasion of breast carcinoma cells in a xenograft mouse model.

Immunogen: Amino acids RNPNDKYEPFWEDEEKNESGLTEYRLVSINKSSPLQK of human PAR-1/Thrombin Receptor were used as the immunogen for the Thrombin Receptor antibody.

Storage: After reconstitution, the Thrombin Receptor antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

View AllClose

Additional Information

Size:
100 ug
View AllClose