Description
Otx2 Antibody | R31757 | Gentaur US, UK & Europe Disrtribition
Family: Primary antibody
Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format: Antigen affinity purified
Clone: N/A
Host Animal: Rabbit
Clonality: Polyclonal (rabbit origin)
Species Reactivity: Human
Application: WB
Buffer: N/A
Limitation: This Otx2 antibody is available for research use only.
Purity: Antigen affinity
Description: Orthodenticle homeobox 2 is also known as CPHD6 or MCOPS5. The OTX2 gene encodes a member of the bicoid subfamily of homeodomain-containing transcription factors. Otx2 acts as a transcription factor and plays a role in brain, craniofacial, and sensory organ development. The encoded protein also influences the proliferation and differentiation of dopaminergic neuronal progenitor cells during mitosis. Mutations in this gene cause syndromic microphthalmia 5 (MCOPS5) and combined pituitary hormone deficiency 6 (CPHD6). Otx2 is also suspected of having an oncogenic role in medulloblastoma. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Pseudogenes of this gene are known to exist on chromosomes two and nine.
Immunogen: An amino acid sequence from the C-terminus of human Orthodenticle homeobox 2 (DYKDQTASWKLNFNADCLDYKDQTSSWKFQVL) was used as the immunogen for this Otx2 antibody (100% mouse homology).
Storage: After reconstitution, the Otx2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.
