Description
OGT Antibody | R31809 | Gentaur US, UK & Europe Disrtribition
Family: Primary antibody
Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format: Antigen affinity purified
Clone: N/A
Host Animal: Rabbit
Clonality: Polyclonal (rabbit origin)
Species Reactivity: Human, Mouse, Rat
Application: WB, IHC-P, IF, FACS
Buffer: N/A
Limitation: This OGT antibody is available for research use only.
Purity: Antigen affinity
Description: O-linked N-acetylglucosamine (O-GlcNAc) transferase (OGT) is an enzyme that in humans is encoded by the OGT gene. This gene encodes a glycosyltransferase that catalyzes the addition of a single N-acetylglucosamine in O-glycosidic linkage to serine or threonine residues. Since both phosphorylation and glycosylation compete for similar serine or threonine residues, the two processes may compete for sites, or they may alter the substrate specificity of nearby sites by steric or electrostatic effects. The protein contains multiple tetratricopeptide repeats that are required for optimal recognition of substrates. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Immunogen: Amino acids NTKQYTMELERLYLQMWEHYAAGNKPDHMIKPVEVTESA of human OGT were used as the immunogen for the OGT antibody.
Storage: After reconstitution, the OGT antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.
