NSE Antibody / Neuron Specific Enolase | RQ4566

NSE Antibody / Neuron Specific Enolase | RQ4566 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Human, Mouse, Rat

Application: WB, IHC-P, IF, FACS

Buffer: N/A

Limitation: N/A

Purity: Antigen affinity purified

Description: NSE (neuron specific enolase), also known as Enolase 2 (ENO2), is found in elevated concentrations in plasma in certain neoplasias. The enolases catalyze the interconversion of 2-phosphoglycerate to phosphoenolpyruvate in the glycolytic pathway. ENO2 gene contains 12 exons distributed over 9,213 nucleotides. Human neurone-specific enolase is mapped to chromosome 12p13.

Immunogen: Amino acids LKAVDHINSTIAPALISSGLSVVEQEKLDNLMLELDGTENK were used as the immunogen for the NSE antibody.

Storage: After reconstitution, the NSE antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.