NPC2 Antibody / Niemann Pick C2 | RQ4408

(No reviews yet) Write a Review
SKU:
800-RQ4408
Size:
100 ug
€986.00
Frequently bought together:

Description

NPC2 Antibody / Niemann Pick C2 | RQ4408 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Human

Application: WB, IHC-P

Buffer: Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

Limitation: This NPC2 antibody is available for research use only.

Purity: Antigen affinity purified

Description: NPC2 is a protein associated with Niemann-Pick disease, type C. This gene is mapped to chromosome 14q24.3. It encodes a protein containing a lipid recognition domain. The encoded protein may function in regulating the transport of cholesterol through the late endosomal/lysosomal system. Mutations in this gene have been associated with Niemann-Pick disease, type C2 and frontal lobe atrophy.

Immunogen: Amino acids KSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQIVS from the human protein were used as the immunogen for the NPC2 antibody.

Storage: After reconstitution, the NPC2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

View AllClose